Report for Sequence Feature Glyma12g04270
Feature Type: gene_model
Chromosome: Gm12
Start: 2807489
stop: 2808748
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma12g04270
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G75540 AT
Annotation by Michelle Graham. TAIR10: salt tolerance homolog2 | chr1:28366059-28367398 FORWARD LENGTH=331
SoyBase E_val: 8.00E-21 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0009641 GO-bp
Annotation by Michelle Graham. GO Biological Process: shade avoidance
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
GO:0008270 GO-mf
Annotation by Michelle Graham. GO Molecular Function: zinc ion binding
SoyBase N/A ISS
UniRef100_D3YBF6 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Salt tolerance-like protein n=1 Tax=Trifolium repens RepID=D3YBF6_TRIRP
SoyBase E_val: 1.00E-26 ISS
UniRef100_I1LPY6 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LPY6_SOYBN
SoyBase E_val: 7.00E-148 ISS
Expression Patterns of Glyma12g04270
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma12g04270
Paralog Evidence Comments
Glyma11g12060 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma12g04270 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.12g038700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma12g04270
Coding sequences of Glyma12g04270
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma12g04270.1 sequence type=CDS gene model=Glyma12g04270 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAGATCCAGTGTGATGTGTGCCACAAAGAAGTGGCCTCCTTCTTCTGCCCCTCAGATGAAGCCTCTCTCTGCCATGCTTGTGATCGCACCATCCACCATCCCAACAAGCTCTCAGAAAAACACAAACGCTTCTCTCTTCACCACCCCATTTCCACCAAAGACTCTCCTCTTTGTGATATCTGTCATGAGAAGCATATGGCTTGTGACAAGGTTTCGGTTTCAACAAGCAGCATTTCTGAGTACTTGATTCAGACCATTCCCGGTTATTGCATGGAAGATCTTCTAGATGCTTCATTCGCATCCAATAGTTTATCTAAGGATTATGAGCACCAATCAGCGTTTCAGAACCAAGATGTTCAAGTCAGCATGCGTTCGTTCCCACTGCAAACTTGGGTACCACAATCTCAAGGTGGATCCCCTCAACGTAGCTTTACTTCGAATCTTTATCCCCAGATTGATTCTTTAGTTGGAGTGATGGAAATGCCTAAAGCCAAAGCTGGTGAAGGATACTCCAATTGGATATATAATTATGACTACGCAGCTTACAAACTTCCTTCAATTTGTCCTCCATTGATCAAAAAAATGCAAACGCTCTCGTTAATCAATTGTATGTGA
Predicted protein sequences of Glyma12g04270
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma12g04270.1 sequence type=predicted peptide gene model=Glyma12g04270 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKIQCDVCHKEVASFFCPSDEASLCHACDRTIHHPNKLSEKHKRFSLHHPISTKDSPLCDICHEKHMACDKVSVSTSSISEYLIQTIPGYCMEDLLDASFASNSLSKDYEHQSAFQNQDVQVSMRSFPLQTWVPQSQGGSPQRSFTSNLYPQIDSLVGVMEMPKAKAGEGYSNWIYNYDYAAYKLPSICPPLIKKMQTLSLINCM*