SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma12g04270

Feature Type:gene_model
Chromosome:Gm12
Start:2807489
stop:2808748
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G75540AT Annotation by Michelle Graham. TAIR10: salt tolerance homolog2 | chr1:28366059-28367398 FORWARD LENGTH=331 SoyBaseE_val: 8.00E-21ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009641GO-bp Annotation by Michelle Graham. GO Biological Process: shade avoidance SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
UniRef100_D3YBF6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Salt tolerance-like protein n=1 Tax=Trifolium repens RepID=D3YBF6_TRIRP SoyBaseE_val: 1.00E-26ISS
UniRef100_I1LPY6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LPY6_SOYBN SoyBaseE_val: 7.00E-148ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g12060 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.12g038700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma12g04270.1   sequence type=CDS   gene model=Glyma12g04270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGATCCAGTGTGATGTGTGCCACAAAGAAGTGGCCTCCTTCTTCTGCCCCTCAGATGAAGCCTCTCTCTGCCATGCTTGTGATCGCACCATCCACCATCCCAACAAGCTCTCAGAAAAACACAAACGCTTCTCTCTTCACCACCCCATTTCCACCAAAGACTCTCCTCTTTGTGATATCTGTCATGAGAAGCATATGGCTTGTGACAAGGTTTCGGTTTCAACAAGCAGCATTTCTGAGTACTTGATTCAGACCATTCCCGGTTATTGCATGGAAGATCTTCTAGATGCTTCATTCGCATCCAATAGTTTATCTAAGGATTATGAGCACCAATCAGCGTTTCAGAACCAAGATGTTCAAGTCAGCATGCGTTCGTTCCCACTGCAAACTTGGGTACCACAATCTCAAGGTGGATCCCCTCAACGTAGCTTTACTTCGAATCTTTATCCCCAGATTGATTCTTTAGTTGGAGTGATGGAAATGCCTAAAGCCAAAGCTGGTGAAGGATACTCCAATTGGATATATAATTATGACTACGCAGCTTACAAACTTCCTTCAATTTGTCCTCCATTGATCAAAAAAATGCAAACGCTCTCGTTAATCAATTGTATGTGA

>Glyma12g04270.1   sequence type=predicted peptide   gene model=Glyma12g04270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKIQCDVCHKEVASFFCPSDEASLCHACDRTIHHPNKLSEKHKRFSLHHPISTKDSPLCDICHEKHMACDKVSVSTSSISEYLIQTIPGYCMEDLLDASFASNSLSKDYEHQSAFQNQDVQVSMRSFPLQTWVPQSQGGSPQRSFTSNLYPQIDSLVGVMEMPKAKAGEGYSNWIYNYDYAAYKLPSICPPLIKKMQTLSLINCM*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo